Skip to Content
Merck
All Photos(7)

Key Documents

WH0001958M3

Sigma-Aldrich

Monoclonal Anti-EGR1 antibody produced in mouse

clone 6E8, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-AT225, Anti-G0S30, Anti-KROX24, Anti-NGFIA, Anti-TIS8, Anti-ZIF268, Anti-ZNF225, Anti-early growth response 1

Sign Into View Organizational & Contract Pricing
All Photos(7)

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

6E8, monoclonal

form

buffered aqueous solution

species reactivity

mouse

technique(s)

immunofluorescence: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

NM_001964

UniProt accession no.

P08046

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... EGR1(1958)

General description

Early-growth response 1 gene (EGR1) is encoded by the gene mapped to human chromosome 5q31.2. The gene codes for a member of the WT-1 family of transcription factors, which contains three Cys2His2 Zn fingers.
The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene. (provided by RefSeq)

Immunogen

EGR1 (NP_001955, 444 a.a. ~ 543 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC

Biochem/physiol Actions

Early-growth response 1 gene (EGR1) facilitates the cellular response to mitogens, stress stimuli and growth factors. It also functions as a tumor suppressor gene in various human cancers. In addition, EGR1 is implicated in the direct regulation of several tumor suppressors such as transforming growth factor β1(TGFβ1), phosphatase and tensin homolog (PTEN), p53 and fibronectin. Mutation in the gene is associated with the development of myeloid disorders.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

The transcription factor Egr1 is a direct regulator of multiple tumor suppressors including TGFbeta1, PTEN, p53, and fibronectin.
Baron V, et al.
Cancer Gene Therapy, 13, 115-124 (2006)
Haploinsufficiency of EGR1, a candidate gene in the del(5q), leads to the development of myeloid disorders.
Joslin JM, et al.
Blood, 110, 719-726 (2007)
Genomic Organization and Chromosomal Localization of the Human Histone Deacetylase 3 Gene
Mahlknecht U, et al.
Genomics, 56, 197-202 (1999)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service