Skip to Content
Merck
All Photos(5)

Key Documents

WH0057492M1

Sigma-Aldrich

Monoclonal Anti-ARID1B antibody produced in mouse

clone 2D2, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-6A35, Anti-AT rich interactive domain 1B (SWI1-like), Anti-BAF250b, Anti-DAN15, Anti-ELD/OSA1, Anti-KIAA1235, Anti-p250R

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Pricing and availability is not currently available.

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2D2, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG2bκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ARID1B(57492)

Related Categories

General description

AT-rich interaction domain 1B (ARID1B) is a member of SWItch/sucrose nonfermentable (SWI/SNF) chromatin remodelling complex. ARID1B gene is located on human chromosome 6q25.3.

Immunogen

ARID1B (NP_059989, 1364 a.a. ~ 1460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNR

Biochem/physiol Actions

AT-rich interaction domain 1B (ARID1B) is involved in the regulation of transcription and multiple downstream cellular processes. ARID1B acts as a coactivator of cell cycle genes. ARID1B acts as tumor suppressor in pancreatic cancer cell line. Mutations in ARID1B might be associated with Coffin-Siris syndrome (CSS).

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

A novel microduplication of ARID1B: Clinical, genetic, and proteomic findings
Seabra C, et al.
American Journal of Medical Genetics. Part A, 173(9), 2478-2484 (2017)
Corpus callosum abnormalities, intellectual disability, speech impairment, and autism in patients with haploinsufficiency of ARID1B
Halgren, et al.
Clinical Genetics, 82(3), 248-255 (2012)
ARID1B, a member of the human SWI/SNF chromatin remodeling complex, exhibits tumour-suppressor activities in pancreatic cancer cell lines
Khurshee et al.
British Journal of Cancer, 108(10), 2056-2056 (2013)
Mutations in SWI/SNF chromatin remodeling complex gene ARID1B cause Coffin-Siris syndrome
Santen G,et al.
Nature Genetics, 44(4), 379-379 (2012)
Dynamics of expression of ARID1A and ARID1B subunits in mouse embryos and in cells during the cell cycle
Flores-A, et al.
Cell and Tissue Research, 345(1), 137-148 (2011)

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service