Skip to Content
Merck
All Photos(4)

Documents

WH0010397M3

Sigma-Aldrich

Monoclonal Anti-NDRG1 antibody produced in mouse

clone 2D7, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-CAP43, Anti-CMT4D, Anti-DRG1, Anti-GC4, Anti-HMSNL, Anti-N-myc downstream regulated gene 1, Anti-NDR1, Anti-NMSL, Anti-PROXY1, Anti-RIT42, Anti-RTP, Anti-TARG1, Anti-TDD5

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2D7, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunofluorescence: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NDRG1(10397)

Related Categories

General description

This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. It is necessary for p53-mediated caspase activation and apoptosis. Mutation in this gene has been reported to be causative for hereditary motor and sensory neuropathy-Lom. Multiple alternatively spliced variants, encoding the same protein, have been identified. (provided by RefSeq)

Immunogen

NDRG1 (AAH03175, 1 a.a. ~ 394 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC

Application

Monoclonal Anti-NDRG1 antibody produced in mouse has been used in immunohistochemistry and Western blotting.

Biochem/physiol Actions

NDRG1 (N-myc downstream regulated 1) is a Rab4a (Ras-related protein Rab-4A) effector protein associated with cell proliferation, differentiation, and invasion. It localizes at the perinuclear recycling/sorting vesicles of trans Golgi network. NDRG1 is essentially required for the p53-dependent apoptosis. At the site of DNA damage, its elevated expression identifies the target genes required for mediating apoptosis. It also plays a major role in the recycling and stabilization of adhesion molecule E-cadherin. In endosome recycling, NDRG1 interacts with the membrane bound Rab4aGTPase. Reports show that NDRG1 acts as a biomarker in the development of colorectal cancer (CRC).

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

N-myc downstream-regulated gene 1 promotes apoptosis in colorectal cancer via up-regulating death receptor 4
Oncotarget, 8(47), 82593?82608-82593?82608 (2017)
The metastasis suppressor, N-myc downregulated gene 1 (NDRG1), is a prognostic biomarker for human colorectal cancer
Zhihai Mao
PLoS ONE, 8 (2013)
Xian Zhang et al.
Oncotarget, 8(47), 82593-82608 (2017-11-16)
The aim of this study was to evaluate the clinical significance of N-myc downstream-regulated gene 1 (NDRG1) in colorectal cancer (CRC) patients and to explore the mechanisms governing the role of NDRG1 in apoptosis of CRC cells. In the current
N-myc downstream-regulated gene 1 downregulates cell proliferation, invasiveness, and tumorigenesis in human oral squamous cell carcinoma.
Jehn-Chuan Lee
Cancer Letters, 355 (2014)
N-myc downstream-regulated gene 1 promotes oxaliplatin-triggered apoptosis in colorectal cancer cells via enhancing the ubiquitination of Bcl-2
Xiao Yang
Oncotarget (2017)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service