Skip to Content
Merck
All Photos(4)

Key Documents

SAB2108448

Sigma-Aldrich

Anti-PCNA

IgG fraction of antiserum

Synonym(s):

Anti-AIT

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Pricing and availability is not currently available.

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

29 kDa

species reactivity

bovine, rat, dog, mouse, human

concentration

0.5-1 mg/mL

technique(s)

immunoblotting: suitable
immunohistochemistry: suitable

accession no.

NM_002592

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PCNA(5111)

General description

Proliferating cell nuclear antigen (PCNA), a nuclear protein, is expressed ubiquitously in mammals. This homotrimer protein is a doughnut-shaped molecule that is expressed at high levels in the thymus, bone marrow, fetal liver, and few cells of the small intestine and colon. PCNA is mainly located in the nucleus. The PCNA gene is a single-copy gene mapped to human chromosome 20p13.

Immunogen

Synthetic peptide directed towards the C terminal region of human PCNA

Application

Anti-PCNA has been used in:
  • immunoblot (1:500)[1][2] (1:1,000)[3] (1:750)[4]
  • far-western analysis (1:1000)[5]
  • immunohistochemistry (1?:?50)[2] (1:1000)[6]
  • proliferating cell nuclear antigen (PCNA) overlay assay (1:1,000)[4]

Biochem/physiol Actions

Proliferating cell nuclear antigen (PCNA) participates in DNA replication and repair. It acts as an auxiliary factor of polymerase δ. It plays a key role in the maturation of Okazaki fragments. It can be used as a prognostic and diagnostic marker in chronic lymphoid leukemia (CLL). High expression of PCNA protein is seen in breast and duodenal cancers.

Sequence

Synthetic peptide located within the following region: LNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Farida E Elbassiouni et al.
Nanomaterials (Basel, Switzerland), 12(3) (2022-02-16)
Colorectal cancer is the third most common cancer. Because curcumin (CUR) has anti-inflammatory and anticancer properties, research has been undertaken to indicate that nanocurcumin compounds can be used to treat a variety of cancers. CUR in nanoform has been found
Kai Li et al.
International journal of molecular medicine, 48(6) (2021-10-12)
Bladder cancer is a common malignant tumor of the urinary system and is associated with a high morbidity and mortality, due to the difficulty in the accurate diagnosis of patients with early‑stage bladder cancer and the lack of effective treatments
Michael J Bertoldo et al.
Reproduction (Cambridge, England), 161(2), 215-226 (2020-12-16)
Ovarian tissue cryopreservation and future transplantation is the only strategy to preserve the fertility of young female adolescent and prepubertal patients. The primary challenge to ovarian graft longevity is the substantial loss of primordial follicles during the period of ischaemia
PCNA (proliferating cell nuclear antigen)
Stoimenov I and Helleday T
Atlas of Genetics and Cytogenetics in Oncology and Haematology (2011)
Qianling Ye et al.
Scientific reports, 14(1), 392-392 (2024-01-04)
The pathogenesis of Acute-on-chronic liver failure (ACLF) involves several forms of cell death, such as pyroptosis, apoptosis, and necroptosis, which consist of PANoptosis. To explore PANoptosis as a regulated cell death pathway in ACLF. Firstly, a bioinformatic strategy was used

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service