SAB1412326

ANTI-AHR antibody produced in mouse

clone 3B9, purified immunoglobulin, buffered aqueous solution

• Synonym(s): AHR, bHLHe76
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3B9, monoclonal
• form: buffered aqueous solution
• mol wt: antigen 36.41 kDa
• species reactivity: human
• technique(s): immunohistochemistry: suitable; indirect ELISA: suitable
• isotype: IgG2aκ
• NCBI accession no.: NM_001621
• UniProt accession no.: P35869
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... AHR(196)

Description

General description

This gene encodes a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Its ligands included a variety of aromatic hydrocarbons. (provided by RefSeq)

Immunogen

AHR (NP_001612, 279 a.a. ~ 376 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EIRTKNFIFRTKHKLDFTPIGCDAKGRIVLGYTEAELCTRGSGYQFIHAADMLYCAESHIRMIKTGESGMIVFRLLTKNNRWTWVQSNARLLYKNGRP

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class Code: 10 - Combustible liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable