Mannose-6-phosphate receptor (cation dependent) (M6PR) is a receptor for mannose-6-phosphate groups on lysosomal enzymes. It is an integral membrane protein that belongs to type I membrane-spanning glycoproteins. M6PR protein exists as a homodimer and localizes in the trans-Golgi reticulum, endosomes, and the plasma membrane. M6PR gene is mapped to human chromosome 12p13.31.
Immunogen
Synthetic peptide directed towards the N terminal region of human M6PR
Biochem/physiol Actions
Mannose-6-phosphate receptor (cation dependent) (M6PR) aids in intracellular targeting of lysosomal enzymes. It mediates the export of newly synthesized acid hydrolases from the trans-Golgi network (TGN) to endosomes for their subsequent transfer to lysosomes. The presence of a cytoplasmic tail in M6PR protects it from lysosomal degradation. in vitro studies suggest that M6PR favors the secretion of pro-cathepsin D in breast cancer cells.
Sequence
Synthetic peptide located within the following region: RLKPLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
The Journal of biological chemistry, 277(21), 18477-18482 (2002-03-12)
The GGAs (Golgi-localizing, gamma-adaptin ear homology domain, ARF-binding) are a multidomain family of proteins implicated in protein trafficking between the Golgi and endosomes. Recent evidence has established that the cation-independent (CI) and cation-dependent (CD) mannose 6-phosphate receptors (MPRs) bind specifically
The two mannose 6-phosphate (M6P) receptors were identified because of their ability to bind M6P-containing soluble acid hydrolases in the Golgi and transport them to the endosomal-lysosomal system. During the past decade, we have started to understand the structural features
Proceedings of the National Academy of Sciences of the United States of America, 94(26), 14471-14476 (1998-02-07)
The 67-amino acid cytoplasmic tail of the cation-dependent mannose 6-phosphate receptor (CD-MPR) contains a signal(s) that prevents the receptor from entering lysosomes where it would be degraded. To identify the key residues required for proper endosomal sorting, we analyzed the
Cancer cells secrete procathepsin D, and its secretion is enhanced by estradiol. Although alterations in the pro-enzyme intracellular transport have been reported, the mechanism by which it is secreted remains poorly understood. In this work, we have studied the influence
Previously we showed that epithelial cell adhesion molecule (Ep-CAM), a cell surface molecule, was highly expressed in primary retinoblastoma tumors. In the present study, we studied the genes regulated by Ep-CAM in a retinoblastoma Y79 cell line in vitro using
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.