GSH2 is a homeobox protein that regulates dorsoventral patterning in mammalian telencephalon. Rabbit Anti-GSH2 antibody recognizes rat, human, mouse, and canine GSH2.
Immunogen
Synthetic peptide directed towards the N terminal region of human GSH2
Application
Rabbit Anti-GSH2 antibody can be used for western blot applications at a concentration of 1μg/ml.
Biochem/physiol Actions
homeobox protein GSH-2
Sequence
Synthetic peptide located within the following region: MSRSFYVDSLIIKDTSRPAPSLPEPHPGPDFFIPLGMPPPLVMSVSGPGC
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Development (Cambridge, England), 128(2), 193-205 (2000-12-22)
The telencephalon has two major subdivisions, the pallium and subpallium. The pallium, which primarily consists of glutamatergic cortical structures, expresses dorsal molecular markers, whereas the subpallium, which primarily consists of the GABAergic basal ganglia, expresses ventral molecular markers. Here, we
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.