Skip to Content
Merck
All Photos(3)

Key Documents

WH0055294M2

Sigma-Aldrich

Monoclonal Anti-FBXW7 antibody produced in mouse

clone 3D1, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-AGO, Anti-CDC4, Anti-DKFZp686F23254, Anti-F-box and WD-40 domain protein 7 (archipelago homolog, Drosophila), Anti-FBW7, Anti-FBX30, Anti-FBXW6, Anti-SEL10

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3D1, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... FBXW7(55294)

Related Categories

General description

F-box and WD40 domain protein 7 (FBXW7) is a member of F-box protein family, which acts as a substrate recognition component of the ubiquitin ligase complex SCF (Skp-Cullin-F-box). The proteins have a bipartite structure. The shared F-box motif links F-box protein to Skp1 and the core complex, whereas divergent protein-protein interaction motifs selectively bind their cognate substrates. There are three FBXW7 isoforms α, β ,γ that share 10 out of 11 exons but they differ in their subcellular localization as well as in substrate recognition activity. The gene encoding FBXW7 is localized on human chromosome 4q31.3.

Immunogen

FBXW7 (NP_361014, 599 a.a. ~ 707 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK

Application

Monoclonal Anti-FBXW7 antibody produced in mouse has been used in Western blotting and immunohistochemistry.

Biochem/physiol Actions

F-box proteins are associated with various signaling pathways, such as nutrient sensing in yeast, conserved developmental pathways in plants and animals. These proteins mediate recognition of phosphorylated targets including Cyclin E, Myc, c-Jun, and Notch, leading to their ubiquitination and degradation. Similar to the inactivation mode of other known tumor suppressors, the SV40 large T antigen binds F-box and WD40 domain protein 7 (FBXW7) without detectible effects on its stability, and thus acts as an inhibitor of FBXW7 activity.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Inactivation of hCDC4 can cause chromosomal instability
Harith Rajagopalan
Nature, 428 (2004)
The F-box: a new motif for ubiquitin dependent proteolysis in cell cycle regulation and signal transduction.
K L Craig and M Tyers
Progress in Biophysics and Molecular Biology, 72 (1999)
MicroRNA-92a contributes to tumor growth of human hepatocellular carcinoma by targeting FBXW7
Wei Yang
Oncology Reports (2015)
F-box proteins: the key to protein degradation
Margaret S Ho
Journal of Biomedical Science, 13 (2006)
Phosphorylation-dependent degradation of c-Myc is mediated by the F-box protein Fbw7
Masayoshi Yada
The Embo Journal, 23 (2004)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service