Skip to Content
Merck
All Photos(1)

Key Documents

AV50258

Sigma-Aldrich

Anti-B3GALT6 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-β3GalT6, Anti-UDP-Gal:βGal β 1,3-galactosyltransferase polypeptide 6

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

37 kDa

species reactivity

human, rat, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

Immunogen

Synthetic peptide directed towards the N terminal region of human B3GALT6

Application

Anti-B3GALT6 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6 (B3GALT6; EDSP2; SEMDJL1) catalyzes the transfer of galactose from UDP-galactose to substrates containing a terminal β-linked galactose moiety. It is localized to Golgi apparatus and is required for glycosaminoglycan synthesis. Aberrations in B3GALT6 gene result in skeletal and connective tissue disorders, collectively known as Ehlers-Danlos syndrome.

Sequence

Synthetic peptide located within the following region: EREQARHGDLLLLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Masahiro Nakajima et al.
American journal of human genetics, 92(6), 927-934 (2013-05-15)
Proteoglycans (PGs) are a major component of the extracellular matrix in many tissues and function as structural and regulatory molecules. PGs are composed of core proteins and glycosaminoglycan (GAG) side chains. The biosynthesis of GAGs starts with the linker region
Fransiska Malfait et al.
American journal of human genetics, 92(6), 935-945 (2013-05-15)
Proteoglycans are important components of cell plasma membranes and extracellular matrices of connective tissues. They consist of glycosaminoglycan chains attached to a core protein via a tetrasaccharide linkage, whereby the addition of the third residue is catalyzed by galactosyltransferase II
X Bai et al.
The Journal of biological chemistry, 276(51), 48189-48195 (2001-09-12)
A family of five beta1,3-galactosyltransferases has been characterized that catalyze the formation of Galbeta1,3GlcNAcbeta and Galbeta1,3GalNAcbeta linkages present in glycoproteins and glycolipids (beta3GalT1, -2, -3, -4, and -5). We now report a new member of the family (beta3GalT6), involved in

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service