Skip to Content
Merck
All Photos(2)

Key Documents

HPA030976

Sigma-Aldrich

Anti-TRPM2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody

Synonym(s):

EREG1, KNP3, LTRPC2, NUDT9H, NUDT9L1, TRPC7

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL

immunogen sequence

IKKMLEVLVVKLPLSEHWALPGGSREPGEMLPRKLKRILRQEHWPSFENLLKCGMEVYKGYMDDPRNTDNAWIETVAVSVHFQDQNDVELNRLNSNLHACDSGASIRWQVVDRRIPLYANHKTLLQK

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TRPM2(7226)

General description

Transient receptor potential cation channel subfamily M member 2 (TRPM2) belongs to the TRPM subfamily and is majorly expressed in the brain especially in substantia nigra, hippocampus, striatum, and cortex. It comprises a C-terminal nudix hydrolase 9 (NUDT9) homology domain, a six-helix transmembrane (TM) domain, a rib helix, and a pole helix. The TRPM2 gene is mapped to human chromosome 21q22.3. Variants of TRPM2 are observed in neutrophil granulocytes.

Immunogen

transient receptor potential cation channel, subfamily M, member 2

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Transient receptor potential cation channel subfamily M member 2 (TRPM2) serves as a calcium-permeable cation channel. It is activated by nicotinamide adenine dinucleotide (NAD), ADP ribose, and by micro levels of hydrogen peroxide (H2O2). The C-terminal NUDT9 homology (NUDT9H) domain mediates adenosine monophosphate (AMP) and ribose-5-phosphate (R5P) synthesis from adenosine diphosphate (ADP)–ribose (ADPR). It is also permeable to sodium and potassium and activated by oxidant stress. TRPM2 via its calcium-signaling responses is involved in various immunological functions and neuroinflammation. It is also correlated to amyloid β (Aβ) generation as well as with the oxidative damage in the pathologies related to Alzheimer′s disease, and other diseases like multiple sclerosis and autism spectrum disorders.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST90730

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Longfei Wang et al.
Science (New York, N.Y.), 362(6421) (2018-11-24)
Transient receptor potential (TRP) melastatin 2 (TRPM2) is a cation channel associated with numerous diseases. It has a C-terminal NUDT9 homology (NUDT9H) domain responsible for binding adenosine diphosphate (ADP)-ribose (ADPR), and both ADPR and calcium (Ca2+) are required for TRPM2
Seung Yeon Ko et al.
Proceedings of the National Academy of Sciences of the United States of America, 116(5), 1770-1775 (2019-01-16)
Major depressive disorder (MDD) is a devastating disease that arises in a background of environmental risk factors, such as chronic stress, that produce reactive oxygen species (ROS) in the brain. The chronic stress-induced ROS production involves Ca2+ signals; however, the
Takuji Uemura et al.
Biochemical and biophysical research communications, 328(4), 1232-1243 (2005-02-15)
Transient receptor potential melastatin 2 (TRPM2) is a calcium-permeable cation channel activated by ADP-ribose or reactive oxygen species. In human, a major transcript of 6.5 kb is expressed in various tissues, whereas a minor transcript of 5.5 kb is detected
Philippa Malko et al.
Frontiers in pharmacology, 10, 239-239 (2019-03-28)
Microglial cells in the central nervous system (CNS) are crucial in maintaining a healthy environment for neurons to function properly. However, aberrant microglial cell activation can lead to excessive generation of neurotoxic proinflammatory mediators and neuroinflammation, which represents a contributing

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service