Skip to Content
Merck
All Photos(2)

Key Documents

WH0003569M1

Sigma-Aldrich

Monoclonal Anti-IL6 antibody produced in mouse

clone 3E4, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-BSF2, Anti-HGF, Anti-HSF, Anti-IFNB2, Anti-IL6, Anti-interleukin 6 (interferon, beta 2)

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3E4, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2bκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... IL6(3569)

General description

Interleukin-6 (IL-6) is a proinflammatory cytokine. The gene encoding it has five exons and is located on human chromosome 7. Human IL-6 is a 21–26 kDa glycoprotein. It has 212 amino acids along with a 28-amino-acid-signal peptide.
This gene encodes a cytokine that functions in inflammation and the maturation of B cells. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. (provided by RefSeq)

Immunogen

IL6 (NP_000591, 29 a.a. ~ 212 a.a) recombinant protein.

Sequence
SPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Biochem/physiol Actions

Interleukin-6 (IL-6) plays a vital role in intracellular signaling pathways. The protein is linked with cancerous cell metastasis and growth. IL-6 serves as a modulator of estrogen synthesis and aromatase activity. IL-6 stimulates immunoglobulin synthesis.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Interleukin 6
Kishimoto T and Tanaka T
Encyclopedia of Inflammatory Diseases, 1-8 (2014)
Targeting interlukin-6 to relieve immunosuppression in tumor microenvironment
Liu Q, et al.
Tumour Biology : the Journal of the International Society For Oncodevelopmental Biology and Medicine, 39(6) (2017)
IL-6 in Inflammation, Immunity, and Disease
Tanaka T, et al.
Cold Spring Harbor Perspectives in Biology (2014)
Meta-analysis of the role of IL-6 rs1800795 polymorphism in the susceptibility to prostate cancer: Evidence based on 17 studies
Liu TZ, et al.
Medicine, 96(11) (2017)
IL-6 variant is associated with metastasis in breast cancer patients
Abana CO, et al.
PLoS ONE, 12(7) (2017)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service