The immunogen for anti-VAMP7 antibody: synthetic peptide derected towards the C terminal of human VAMP7
Biochem/physiol Actions
Vamp7 is involved in the targeting and/or fusion of transport vesicles to their target membrane during transport of proteins from the early endosome to the lysosome. Vamp7 is required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion.Vamp7 is required for calcium regulated lysosomal exocytosis. Vamp7 is involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi.Vamp7 is required for exocytosis of mediators during eosinophil and neutrophil degranulation, and target cell killing by natural killer cells. Vamp7 is also required for focal exocytosis of late endocytic vesicles during phagosome formation.
Sequence
Synthetic peptide located within the following region: DELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMC
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
