Synthetic peptide directed towards the C terminal region of human POU4F1
Biochem/physiol Actions
POU4F1 is a neural transcription factor that is involved in the development of sensory nervous system. POU domain factors are characterized by the DNA-binding POU domain that is highly conserved. These factors bind to DNA and regulate transcription by protein-protein interactions. POU domain factors are critical regulators of early embryogenesis, development of mammalian forebrain, development and function of neuroendocrine system, regulation of gene expression in pituitary gland and hypothalamus.
Sequence
Synthetic peptide located within the following region: LEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
The sensory neurons of the dorsal root ganglia (DRG) must project accurately to their central targets to convey proprioceptive, nociceptive and mechanoreceptive information to the spinal cord. How these different sensory modalities and central connectivities are specified and coordinated still
POU domain factors are transcriptional regulators characterized by a highly conserved DNA-binding domain referred to as the POU domain. The structure of the POU domain has been solved, facilitating the understanding of how these proteins bind to DNA and regulate
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
