Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

374087

Sigma-Aldrich

Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1)

liquid, clone HO-1-1, Calbiochem®

Sinónimos:

Anti-HO-1, Anti-Hsp32

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
clone:
HO-1-1, monoclonal
application:
species reactivity:
human, rat, canine, monkey, mouse, bovine
citations:
9

biological source

mouse

Quality Level

antibody form

purified antibody

antibody product type

primary antibodies

clone

HO-1-1, monoclonal

form

liquid

contains

≤0.1% sodium azide as preservative

species reactivity

human, rat, canine, monkey, mouse, bovine

manufacturer/tradename

Calbiochem®

storage condition

OK to freeze
avoid repeated freeze/thaw cycles

isotype

IgG1

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

bovine ... Hmox1(513221)
dog ... Hmox1(442987)
human ... HMOX1(3162)
mouse ... Hmox1(15368)
rat ... Hmox1(24451)
rhesus monkey ... Hmox1(719266)

General description

Anti-Heme Oxygenase-1, mouse monoclonal, clone HO-1-1, recognizes the ~32 kDa HO-1 in a variety of species. It is validated for use in Western blotting, immunocytochemistry, and immunoprecipitation.
Protein G purified mouse monoclonal antibody. Recognizes the ~32 kDa heme oxygenase (HO-1) protein.
Recognizes the ~32 kDa HO-1 protein.

Immunogen

Human
a synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide

Application

Immunoblotting (4 µg/ml, chemiluminescence)

Immunocytochemistry (1:1000)

Immunoprecipitation (20 µg/ml)

Packaging

Please refer to vial label for lot-specific concentration.

Warning

Toxicity: Standard Handling (A)

Physical form

In PBS, 50% glycerol.

Reconstitution

Following initial thaw, aliquot and freeze (-20°C).

Other Notes

Does not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Maines, M.D. 1988. FASEB J.2, 2557.
Trakshel, G.M., et al. 1986 J. Biol. Chem.261, 11131.

Legal Information

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

László Potor et al.
Oxidative medicine and cellular longevity, 2018, 3812568-3812568 (2018-03-22)
The infiltration of red blood cells into atheromatous plaques is implicated in atherogenesis. Inside the lesion, hemoglobin (Hb) is oxidized to ferri- and ferrylHb which exhibit prooxidant and proinflammatory activities. Cystathione gamma-lyase- (CSE-) derived H2S has been suggested to possess
László Potor et al.
Oxidative medicine and cellular longevity, 2013, 676425-676425 (2013-06-15)
Oxidized cell-free hemoglobin (Hb), including covalently cross-linked Hb multimers, is present in advanced atherosclerotic lesions. Oxidation of Hb produces methemoglobin (Fe(3+)) and ferryl hemoglobin (Fe(4+) = O(2-)). Ferryl iron is unstable and can return to the Fe(3+) state by reacting
Hai Lu et al.
Brain sciences, 14(5) (2024-05-25)
The discovery of novel diagnostic methods and therapies for Alzheimer's disease (AD) faces significant challenges. Previous research has shed light on the neuroprotective properties of Apelin-13 in neurodegenerative disorders. However, elucidating the mechanism underlying its efficacy in combating AD-related nerve
Steven J T Jackson et al.
Food and chemical toxicology : an international journal published for the British Industrial Biological Research Association, 60, 431-438 (2013-08-14)
Curcumin, a component of turmeric spice that imparts flavor and color to curry, is thought to possess anti-inflammatory and antioxidant properties in biological tissues. However, while such efficacies have been described in the context of carcinogenesis, the impact of curcumin
Ming Shu et al.
Molecular medicine reports, 13(4), 3036-3042 (2016-03-05)
Tanshinone IIA is extracted from the root of Salvia miltiorrhiza and used in traditional Chinese medicine for its anti-inflammatory activity and antioxidant effects. The aim of the present study was to investigate the potential protective effects of tanshinone IIA against

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico