Skip to Content
Merck
All Photos(6)

Key Documents

WH0007137M4

Sigma-Aldrich

Monoclonal Anti-TNNI3 antibody produced in mouse

clone 1E7, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-CMH7, Anti-MGC116817, Anti-TNNC1, Anti-cTnI, Anti-troponin I type 3 (cardiac)

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1E7, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TNNI3(7137)

General description

Troponin I3, cardiac type (TNNI3), also known as cardiac troponin I (cTnI), is the inhibitory element of troponin. It possesses an inhibitory peptide (IP) domain and a switch peptide (SP) domain that is located N-terminal of the IP domain. The gene encoding TNNI3 is localized on human chromosome 19q13.42.

Immunogen

TNNI3 (NP_000354, 102 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES

Biochem/physiol Actions

Troponin I3, cardiac type (TNNI3) or cardiac troponin I (cTnI) modulates the diastolic function of the heart. Low expression of TNNI3 is associated with cardiac diastolic dysfunction. Elevated expression of the protein indicates cardiac injury. TNNI3 is a biomarker for myocardial infarction and mutations in the gene encoding it have been linked to hypertrophic cardiomyopathy.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Customers Also Viewed

Slide 1 of 1

1 of 1

Tünde Berecz et al.
ESC heart failure, 9(1), 224-235 (2021-12-22)
Hippo signalling is an evolutionarily conserved pathway that controls organ size by regulating apoptosis, cell proliferation, and stem cell self-renewal. Recently, the pathway has been shown to exert powerful growth regulatory activity in cardiomyocytes. However, the functional role of this
Clinical performance of cardiac Troponin I: A comparison between the POCT AQT90 FLEX and the Dimension Vista analyzer in an emergency setting.
Mion MM
Clinical Biochemistry (2017)
Restrictive Cardiomyopathy Troponin I R145W Mutation Does Not Perturb Myofilament Length-dependent Activation in Human Cardiac Sarcomeres.
Dvornikov AV
The Journal of Biological Chemistry (2016)
Marta Zarà et al.
International journal of molecular sciences, 22(15) (2021-08-08)
The identification of new biomarkers allowing an early and more accurate characterization of patients with ST-segment elevation myocardial infarction (STEMI) is still needed, and exosomes represent an attractive diagnostic tool in this context. However, the characterization of their protein cargo
Diastolic dysfunction and cardiac troponin I decrease in aging hearts.
Pan B
Archives of Biochemistry and Biophysics (2016)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service