WH0007038M1

Monoclonal Anti-TG antibody produced in mouse

clone 1G3, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-AITD3, Anti-thyroglobulin
• MDL number: MFCD00164673
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1G3, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• GenBank accession no.: NM_003235
• UniProt accession no.: P01266
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... TG(7038)

Description

General description

Thyroglobulin (TG) is a 660 kDa homodimeric glycoprotein, secreted by endoplasmic reticulum. The gene is located on human chromosome 8q24.22. It is majorly expressed in thyroid gland.

Immunogen

TG (NP_003226, 2659 a.a. ~ 2768 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
FSHFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWSKYISSLKTSADGAKGGQSAESEEEELTAGSGLREDLLSLQEPGSKTYSK

Biochem/physiol Actions

Thyroglobulin (TG) regulates iodide storage and synthesis of thyroid hormones, thyroxine (T₄) and triiodothyronine (T₃). Mutations in TG is associated with goiter and congenital hypothyroidism. Polymorphisms in this gene is linked to autoimmune thyroid diseases (AITD) like, Graves′ disease and Hashimoto thyroiditis.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves