Skip to Content
Merck
All Photos(6)

Key Documents

HPA010593

Sigma-Aldrich

Anti-FOLH1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Glutamate carboxypeptidase 2 antibody produced in rabbit, Anti-Glutamate carboxypeptidase II antibody produced in rabbit, Anti-Membrane glutamate carboxypeptidase antibody produced in rabbit, Anti-N-acetylated-α-linked acidic dipeptidase I antibody produced in rabbit, Anti-NAALADase I antibody produced in rabbit, Anti-Pteroylpoly-γ-glutamate carboxypeptidase antibody produced in rabbit, Anti-mGCP antibody produced in rabbit

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€505.00

€505.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
€505.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

€505.00


Please contact Customer Service for Availability

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:200- 1:500

immunogen sequence

ADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNF

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... FOLH1(2346)

General description

FOLH1 (folate hydrolase 1) is a type II membrane protein, which is composed of a cytosolic domain, a transmembrane region, and an exoplasmic region. This protein exhibits both constitutive and induced internalization.[1] It is an exopeptidase, which is Zn-dependent and is localized on the brush-border of the intestine.

Immunogen

Glutamate carboxypeptidase 2 recombinant protein epitope signature tag (PrEST)

Application

Anti-FOLH1 antibody produced in rabbit has been used for FACS (flourescence activated cell sorting)-based epitope mapping. Anti-FOLH1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

FOLH1 (folate hydrolase 1) is also known as prostate-specific membrane antigen (PSMA) and is over and strongly expressed in prostate cancer cells, including metastatic cells. This protein functions both as an N-acetylated a-linked acidic dipeptidase (NAALADase) and folate hydrolase (FOLH).[1] In small intestine, it is responsible for the absorption of dietary polyglutamylated folates (folyl-n-γ-l-glutamic acid), which are the provitamin form of folic acid. Variants in this gene are linked with folate nutritional status and disease susceptibility, and its interaction with dietary natural vitamin C might be linked with the susceptibility to adenomatous polyp.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71680

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Jeong-Hwa Choi et al.
Asian Pacific journal of cancer prevention : APJCP, 16(10), 4383-4386 (2015-06-02)
The C1561T variant of the glutamate carboxypeptidase II (GCPII) gene is critical for natural methylfolylpolyglutamte (methylfolate) absorption, and has been associated with perturbations in folate metabolism and disease susceptibility. However, little is known on C1561T-GCPII as a risk factor for
Tiancheng Liu et al.
International journal of oncology, 44(3), 918-922 (2014-01-16)
Developing simple and effective approaches to detect tumor markers will be critical for early diagnosis or prognostic evaluation of prostate cancer treatment. Prostate‑specific membrane antigen (PSMA) has been validated as an important tumor marker for prostate cancer progression including angiogenesis
Michal Navrátil et al.
The FEBS journal, 281(14), 3228-3242 (2014-05-28)
In addition to its well-characterized role in the central nervous system, human glutamate carboxypeptidase II (GCPII; Uniprot ID Q04609) acts as a folate hydrolase in the small intestine, participating in the absorption of dietary polyglutamylated folates (folyl-n-γ-l-glutamic acid), which are
Elton P Hudson et al.
Scientific reports, 2, 706-706 (2012-10-11)
As antibody-based diagnosis and therapy grow at an increased pace, there is a need for methods which rapidly and accurately determine antibody-antigen interactions. Here, we report a method for the multiplex determination of antibody epitopes using bacterial cell-surface display. A
Martin K Bakht et al.
Endocrine-related cancer, 26(2), 131-146 (2018-11-08)
Prostate-specific membrane antigen (PSMA) is overexpressed in most prostate adenocarcinoma (AdPC) cells and acts as a target for molecular imaging. However, some case reports indicate that PSMA-targeted imaging could be ineffectual for delineation of neuroendocrine (NE) prostate cancer (NEPC) lesions

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service