SIN3B codes for SIN3 transcription regulator family member B that interacts with Mad1. It is also known to form a nucleolar complex with leukemia associated ETO homologs. Rabbit Anti-SIN3B antibody recognizes human, bovine, and mouse SIN3B.
Immunogen
Synthetic peptide directed towards the middle region of human SIN3B
Application
Rabbit Anti-SIN3B antibody is suitable for western blot applications at a concentration of 1μg/ml.
Biochem/physiol Actions
SIN3B acts as a transcriptional repressor. It interacts with MXI1 to repress MYC responsive genes and antagonize MYC oncogenic activities.It also interacts with MAD-MAX heterodimers by binding to MAD. The heterodimer then represses transcription by tethering SIN3B to DNA. SIN3B also forms a complex with FOXK1 which represses transcription.
Sequence
Synthetic peptide located within the following region: NDTKALRSKSLLNEIESVYDEHQEQHSEGRSAPSSEPHLIFVYEDRQILE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Sin3A or Sin3B are components of a corepressor complex that mediates repression by transcription factors such as the helix-loop-helix proteins Mad and Mxi. Members of the Mad/Mxi family of repressors play important roles in the transition between proliferation and differentiation
SIN3 (SWI-Independent) is part of a transcriptional deacetylase complex, which generally mediates the formation of repressive chromatin. The purpose of this work was to study possible interactions between corepressors human SIN3B (hSIN3B) and the ETO homologues - ETO (eight twenty-one)
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
