Synthetic peptide directed towards the N terminal region of human EIF2S3
Application
Anti-EIF2S3 antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/ml.
Biochem/physiol Actions
EIF2S3 gene encodes a eukaryotic translation initiation factor 2, subunit 3 gamma protein of 52kDa. It is the core subunit of the heterotrimeric GTP-binding protein that facilitates the recruitment of methionyl-tRNA to the 40S ribosomal subunit.
Sequence
Synthetic peptide located within the following region: LDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDI
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Together with GTP and initiator methionyl-tRNA, translation initiation factor eIF2 forms a ternary complex that binds the 40S ribosome and then scans an mRNA to select the AUG start codon for protein synthesis. Here, we show that a human X-chromosomal
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.