SAB2106860

Anti-PORCN antibody produced in rabbit

affinity isolated antibody

• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• mol wt: 51 kDa
• species reactivity: mouse, bovine, rabbit, guinea pig, human, dog, rat, horse
• packaging: pkg of 100 μL buffered aqueous solution; pkg of 50 μg lyophilized powder
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NM_016913
• UniProt accession no.: Q9JJJ7-4
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PORCN(64840) ; mouse ... Porcn(53627)

Description

Immunogen

The immunogen for anti-PORCN antibody: synthetic peptide derected towards the middle region of human PORCN

Biochem/physiol Actions

Porcn modulates the processing of Wnt proteins. Probable protein-cysteine N-palmitoyltransferase that palmitoylates Wnt family members.

Sequence

Synthetic peptide located within the following region: VAMKAVSLGFDLDRGEVGAVPSPVEFMGYLYFVGTIVFGPWISFHSYLQA

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable