SAB2106444

Anti-TCF20 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-AR1, Anti-DDVIBA, Anti-SPBP, Anti-TCF-20
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 212 kDa
• species reactivity: human, bovine, dog, horse, rabbit, mouse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• NCBI accession no.: NM_005650
• UniProt accession no.: Q9UGU0
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... TCF20(6942)

Description

Immunogen

Synthetic peptide directed towards the C terminal region of human TCF20

Biochem/physiol Actions

The protein encoded by this gene binds a platelet-derived growth factor-responsive element in the matrix metalloproteinase 3 (stromelysin 1) promoter. The protein localizes to the nucleus and displays DNA-binding and transactivation activities. It is thought to be a transcriptional coactivator, enhancing the activity of transcription factors such as JUN and SP1.

Sequence

Synthetic peptide located within the following region: HYPCAIDADCLLHEENFSVRCPKHKPPLPCPLPPLQNKTAKGSLSTEQSE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 12 - Non Combustible Liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable