SAB2105760

Anti-YY1AP1 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-FLJ10875, Anti-FLJ13914, Anti-HCCA1, Anti-HCCA2, Anti-YAP
• MDL number: MFCD04118707
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 83 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NM_139119
• UniProt accession no.: Q9H869
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... YY1AP1(55249)

Description

General description

The previously assigned protein identifier D3DV96 has been merged into Q9H869. Full details can be found on the UniProt database.

Immunogen

Synthetic peptide directed towards the middle region of human YY1AP1

Biochem/physiol Actions

The encoded gene product presumably interacts with YY1 protein; however, its exact function is not known. Alternative splicing results in multiple transcript variants encoding different isoforms.

Sequence

Synthetic peptide located within the following region: WTVVKTEEGRQALEPLPQGIQESLNNSSPGDLEEVVKMEPEDATEEISGF

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable