SAB1412414

ANTI-MEOX1 antibody produced in mouse

clone 3D6, purified immunoglobulin, buffered aqueous solution

• Synonym(s): MEOX1, MOX1
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3D6, monoclonal
• form: buffered aqueous solution
• mol wt: antigen 35.41999 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: NM_004527
• UniProt accession no.: P50221
• shipped in: dry ice
• Storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... MEOX1(4222)

Description

General description

This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described. (provided by RefSeq)

Immunogen

MEOX1 (NP_004518, 82 a.a. ~ 170 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSK*

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable