SAB1409284

Monoclonal Anti-LFNG antibody produced in mouse

clone 3B5, purified immunoglobulin, buffered aqueous solution

• Synonym(s): SCDO3
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3B5, monoclonal
• form: buffered aqueous solution
• mol wt: antigen 39.49 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable
• isotype: IgG2bκ
• NCBI accession no.: NM_002304
• UniProt accession no.: Q8NES3
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... LFNG(3955)

Description

General description

This gene encodes a member of the glycosyltransferase superfamily. The encoded protein is a single-pass type II Golgi membrane protein that functions as a fucose-specific glycosyltransferase, adding an N-acetylglucosamine to the fucose residue of a group of signaling receptors involved in regulating cell fate decisions during development. Mutations in this gene have been associated with autosomal recessive spondylocostal dysostosis 3. Alternatively spliced transcript variants that encode different isoforms have been described, however, not all variants have been fully characterized. (provided by RefSeq)

Immunogen

LFNG (NP_002295, 1 a.a. ~ 125 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MTPGRCCLAADIQVETFIFTDGEDEALARHTGNVVITNCSAAHSRQALSCKMAVEYDRFIESGRKWFCHVDDDNYVNLRALLRLLASYPHTRDVYVGKPSLDRPIQAMERVSENKVRPVHFWFAT*

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable