SAB1402789

Monoclonal Anti-GLE1 antibody produced in mouse

clone 1D8, purified immunoglobulin, buffered aqueous solution

• Synonym(s): GLE1L, LCCS, LCCS1, hGLE1
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1D8, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37.22 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• NCBI accession no.: NM_001003722
• UniProt accession no.: Q53GS7
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... GLE1(2733)

Description

General description

This gene encodes a predicted 75-kDa polypeptide with high sequence and structure homology to yeast Gle1p, which is nuclear protein with a leucine-rich nuclear export sequence essential for poly(A)+RNA export. Inhibition of human GLE1L by microinjection of antibodies against GLE1L in HeLa cells resulted in inhibition of poly(A)+RNA export. Immunoflourescence studies show that GLE1L is localized at the nuclear pore complexes. This localization suggests that GLE1L may act at a terminal step in the export of mature RNA messages to the cytoplasm. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Immunogen

GLE1 (NP_001003722.1, 140 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RMKGTEGLRLWQEEQERKVQALSEMASEQLKRFDEWKELKQHKEFQDLREVMEKSSREALGHQEKLKAEHRHRAKILNLKLREAEQQRVKQAEQERLRKEE

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable