SAB1402721

Monoclonal Anti-CGB, (C-terminal) antibody produced in mouse

clone 3B4, purified immunoglobulin, buffered aqueous solution

• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3B4, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~36.56 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• NCBI accession no.: BC041054.1
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CGB(1082)

Description

General description

This gene is a member of the glycoprotein hormone beta chain family and encodes the beta 3 subunit of chorionic gonadotropin (CG). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. CG is produced by the trophoblastic cells of the placenta and stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. The beta subunit of CG is encoded by 6 genes which are arranged in tandem and inverted pairs on chromosome 19q13.3 and contiguous with the luteinizing hormone beta subunit gene. (provided by RefSeq)

Immunogen

CGB (AAH41054.1, 70 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable