SAB1402559

Monoclonal Anti-PVRL3 antibody produced in mouse

clone 1D1, purified immunoglobulin, buffered aqueous solution

• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1D1, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37.99 kDa
• species reactivity: human
• technique(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: NM_015480
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PVRL3(25945)

Description

General description

Poliovirus receptor-related 3 (PVRL3), popularly known as nectin cell adhesion molecule 3 (NECTIN3), is expressed in various cells. It is part of the nectin family of proteins, which are cell adhesion molecules that modulate adherens junction formation. PVRL3 is a membrane protein with three extracellular immunoglobulin domains. The gene encoding it is localized on human chromosome 3q13.13.

Immunogen

PVRL3 (NP_056295, 59 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PIIVEPHVTAVWGKNVSLKCLIEVNETITQISWEKIHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTV

Application

Monoclonal Anti-PVRL3 antibody produced in mouse has been used for immunohistochemistry.

Biochem/physiol Actions

Poliovirus receptor-related 3 (PVRL3) or nectin cell adhesion molecule 3 (NECTIN3) forms heterotypic adhesions with PVR, PVRL1 and PVRL2. The protein is involved in lymphocyte and monocyte extravasation. It also associates with afadin. PVRL3 has a role in the development of mammalian lens and ciliary body.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable