Skip to Content
MilliporeSigma
All Photos(2)

Documents

HPA023561

Sigma-Aldrich

Anti-TRIM8 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab2

Synonym(s):

Anti-GERP, Anti-RNF27, Anti-tripartite motif-containing 8

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

QDIEDQLYKLESDKRLVEEKVNQLKEEVRLQYEKLHQLLDEDLRQTVEVLDKAQAKFCSENAAQALHLGERMQEAKKLLGS

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TRIM8(81603)

General description

The gene TRIM8 (tripartite motif containing 8) encodes a RING (really interesting new gene) finger protein that contains a tripartite motif. It spans a length of 551-amino acids. The gene maps to human chromosome 10q24.3. The encoded protein contains a RING finger and a coiled-coil domain interspaced by two B boxes. It is universally expressed in adult tissues and several cancers.

Immunogen

tripartite motif-containing 8 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

The gene TRIM8 (tripartite motif containing 8) encodes a member of the RBCC (RING finger, B-box, and coiled-coil) subclass of proteins, which are involved in several processes, such as development and cell-growth regulation. Trim8 interacts with the SH2 domain and the SOCS box of SOCS-1 (suppressor of cytokine signaling), and regulates IFN-γ (Interferon γ) cytokine signaling. Trim8 also positively regulates tumor necrosis factor-α (TNFα) and interleukin-1β (IL-1β)–triggered activation of NF-κB (nuclear factor-κB), a transcription factor that participates in cell proliferation, inhibition of apoptosis, and innate immunity. Cellular stress induces the expression of this protein, which in turn stabilizes p53 resulting in cell cycle arrest and reduction of cell proliferation. Mutations in this gene have been associated with Mendelian disease, several types of cancer and viral infection.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST76066

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

TRIM8/GERP RING finger protein interacts with SOCS-1.
Toniato E
The Journal of Biological Chemistry, 277, 37315-37322 (2002)
Zelin Tian et al.
American journal of cancer research, 10(10), 3440-3457 (2020-11-10)
Breast cancer (BC) is the most common female malignancy worldwide, and 70% of which are estrogen receptor α (ERα) positive. Endocrine treatment, such as tamoxifen, is a primary adjuvant therapy for patients with ER-positive BC. However, some patients will develop
Tripartite motif 8 (TRIM8) modulates TNFa- and IL-1?-triggered NF-?B activation by targeting TAK1 for K63-linked polyubiquitination.
Li Q
Proceedings of the National Academy of Sciences of the USA, 108, 19341-19346 (2011)
TRIM8 modulates p53 activity to dictate cell cycle arrest.
Caratozzolo MF
Cell Cycle, 11, 511-523 (2012)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service