As recommended in the Properties section under technique(s), the suggested dilution factors are as follows:
IHC (Immunohistochemistry) - 1:2500 - 1:5000
WB (Western Blot) - 0.04 - 0.4 µg/mL
ICC-IF (Immunofluorescence) - 0.25 - 2 µg/mL
Please review the Certificate of Analysis for lot-specific values.
HPA014784
Anti-Aquaporin-4 Antibody
![Enhanced Validation antibodies are tested to ensure reproducibility, specificity, and performance using our enhanced validation strategies enhanced validation](/static/enhanced_validation_badge.png)
Prestige Antibodies® Powered by Atlas Antibodies, rabbit polyclonal
Synonym(s):
Anti-AQP-4, Anti-Aquaporin-4, Anti-MIWC, Anti-Mercurial-insensitive water channel, Anti-WCH4
Select a Size
$555.00
Estimated to ship onFebruary 12, 2025
Select a Size
About This Item
$555.00
Estimated to ship onFebruary 12, 2025
Recommended Products
Product Name
Anti-AQP4 antibody produced in rabbit, affinity isolated antibody, Prestige Antibodies® Powered by Atlas Antibodies, buffered aqueous glycerol solution
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human, mouse
enhanced validation
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:2500-1:5000
immunogen sequence
CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... AQP4(361)
General description
Immunogen
Application
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
Features and Benefits
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Physical form
Legal Information
Disclaimer
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 1
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Customers Also Viewed
-
How can I find a Specification/description PDF hat contains suggested dilutions, images of Westernblots and IF and Histochemistry to download for this antibody? Anti AQP4 HPA014784
1 answer-
Helpful?
-
-
Does the AQP4 antibody bind to intracellular or extracellular domain of the protein
1 answer-
The antigen this antibody is raised against is the last 72 aa residues in the AQP4 protein sequence. This peptide is available as product APREST73067 https://www.sigmaaldrich.com/US/en/product/sigma/aprest73067. According to Uniprot, this is located on a cytoplasmic region of the protein. https://www.uniprot.org/uniprotkb/P55087/feature-viewer.
Helpful?
-
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service