HPA006408

Anti-CNOT3 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(s): Anti-CCR4-NOT transcription complex subunit 3 antibody produced in rabbit, Anti-CCR4-associated factor 3 antibody produced in rabbit, Anti-Leukocyte receptor cluster member 2 antibody produced in rabbit
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA006408
• NACRES: NA.41

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• technique(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• immunogen sequence: TPAPYAQAVAPPAPSGPSTTQPRPPSVQPSGGGGGGSGGGGSSSSSNSSAGGGAGKQNGATSYSSVVADSPAEVALSSSGGNNASSQALGPPSGPHNPPPSTSKEPSA
• UniProt accession no.: O75175
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CNOT3(4849)

Description

General description

CNOT3 (CCR4-NOT transcription complex subunit 3) is a member of the conserved multi-protein complex called CCR4-NOT. This gene is localized to human chromosome 19q13.4. It contains the conserved Not-Box motif in its C-terminal.

Immunogen

CCR4-NOT transcription complex subunit 3 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

CNOT3 (CCR4-NOT transcription complex subunit 3) is a part of CCR4-Not complex, which plays an essential role in the control of gene expression. It negatively regulates gene transcription by either directly interacting with the promoter of the target gene, or by modulating the rate of target mRNA degradation. It directly interacts with and suppresses PRPF31 (Pre-MRNA Processing Factor 31) expression. Thus, it modulates PRPF31 mutations in retinitis pigmentosa. It also functions as a tumor suppressor, and is mutated in certain cases of adult T-cell acute lymphoblastic leukemia (T-ALL). It plays an essential role in maintaining the embryonic stem cell (ESC) properties in humans and mice. It prevents ES differentiation into extra-embryonic lineages.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70863

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)