Skip to Content
MilliporeSigma
All Photos(3)

Key Documents

AV54575

Sigma-Aldrich

Anti-GFRA2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-GDNF family receptor α2, Anti-GDNFRB, Anti-NRTNR-ALPHA, Anti-NTNRA, Anti-RETL2, Anti-TRNR2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

47 kDa

species reactivity

horse, dog, mouse, rat, human, pig, rabbit

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... GFRA2(2675)

Immunogen

Synthetic peptide directed towards the C terminal region of human GFRA2

Application

Anti-GFRA2 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

GFRA2 are cell surface bound glycoproteins that mediate interactions of the glial-cell-line-derived neurotrophic factor (GDNF) ligand family with the RET receptor that are crucial for the development of kidney and some peripheral nerve lineages. GFRA2 gene is shown to be associated with tardive dyskinesia in a study. The factors GDNF and neurturin, along with their receptors GFRA1 and GFRA2, respectively, are crucial for enteric neuron survival in human colon. The gene is shown to be associated with schizophrenia and clozapine response in a study. It is associated with severe abdominal pain sensation in pancreatic cancer patients.

Sequence

Synthetic peptide located within the following region: NVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

M Barrenschee et al.
Cell and tissue research, 354(2), 371-380 (2013-07-25)
Two of the glial-cell-line-derived neurotrophic factor (GDNF) family ligands (GFLs), namely GDNF and neurturin (NRTN), are essential neurotropic factors for enteric nerve cells. Signal transduction is mediated by a receptor complex composed of GDNF family receptor alpha 1 (GFRα1) for
J B Vanhorne et al.
Human genetics, 108(5), 409-415 (2001-06-21)
The glial-cell-line-derived neurotrophic factor (GDNF) family receptors alpha (GFRalpha) are cell surface bound glycoproteins that mediate interactions of the GDNF ligand family with the RET receptor. These interactions are crucial to the development of the kidney and some peripheral nerve
Kun Wang et al.
Carcinogenesis, 35(1), 103-113 (2013-09-27)
Neurotrophic factors possess an emerging role in the pathophysiology of several gastrointestinal disorders, regulating innervation, pain sensation and disease-associated neuroplasticity. Here, we aimed at characterizing the role of the neurotrophic factor neurturin (NRTN) and its receptor glial-cell-line-derived neurotrophic factor receptor
Renan P Souza et al.
Journal of psychiatric research, 44(11), 700-706 (2010-02-02)
GDNF (glial-cell-line derived neurotrophic factor) is a potent neurotrophic factor for dopaminergic neurons. Neuropsychiatric diseases and their treatments are associated with alterations in the levels of both GDNF and its receptor family (GDNF family receptor alpha or GFRA). GFRA1, GFRA2
Renan P Souza et al.
Psychopharmacology, 210(3), 347-354 (2010-04-07)
Tardive dyskinesia (TD) has a pharmacogenetic component in which the interaction of antipsychotic exposure with individual genetic variation mediates risk. The glial cell line-derived neurotrophic factor (GDNF) signalling pathway has been associated with neuroprotective effects in central dopaminergic neurons and

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service