Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

AV50256

Sigma-Aldrich

Anti-CYTB antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Cytochrome b

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
$541.00

$541.00


Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)


Select a Size

Change View
100 μL
$541.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

$541.00


Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

42 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MTCYB(4519)

General description

Mitochondrially encoded cytochrome b (MT-CYB; CYTB) is encoded by mitochondrial DNA.

Immunogen

Synthetic peptide directed towards the N terminal region of human CYTB

Application

Anti-CYTB antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

Mitochondrially encoded cytochrome b (MT-CYB; CYTB) is a component of complex III mitochondrial respiratory chain. Mutations in CYTB are associated with hypertrophic cardiomyopathy and Leber′s hereditary optic neuropathy. CYTB is up-regulated in uterine leiomyomas compared with myometrium tissues. Homoplasmic alteration in CYTB has been associated with colorectal cancer. Mutation in CYTB is also detected in primary bladder cancer patient. Cleaved CYTB protein functions as cytoplasmic mediator of FAS-induced apoptosis.

Sequence

Synthetic peptide located within the following region: TPMRKINPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Christian M Hagen et al.
Molecular genetics & genomic medicine, 1(1), 54-65 (2014-02-06)
Mitochondrial dysfunction is a characteristic of heart failure. Mutations in mitochondrial DNA, particularly in MT-CYB coding for cytochrome B in complex III (CIII), have been associated with isolated hypertrophic cardiomyopathy (HCM). We hypothesized that MT-CYB mutations might play an important
M D Brown et al.
Genetics, 130(1), 163-173 (1992-01-01)
Four new missense mutations have been identified through restriction analysis and sequencing of the mitochondrial DNAs (mtDNA) from Leber's hereditary optic neuropathy (LHON) patients who lacked the previously identified 11778 mutation. Each altered a conserved amino acid and correlated with
Naoto Chihara et al.
Journal of Nippon Medical School = Nippon Ika Daigaku zasshi, 78(1), 13-21 (2011-03-11)
Somatic mutations of mitochondrial DNA (mtDNA) have been reported in different types of cancers and are suggested to play roles in metastasis, cancer development and response to anticancer agents. To predict potential roles of mtDNA alterations in colorectal cancer, we
Santanu Dasgupta et al.
International journal of cancer, 125(12), 2829-2835 (2009-07-02)
Mitochondria encoded Cytochrome B (CYTB) gene mutations were reported in tumors of different anatomic origin but the functional significance of these mutations are not well studied. Earlier, we found a 7-amino acid deletion mutation in the CYTB gene in a
Noor Ahmad Shaik et al.
Gynecological endocrinology : the official journal of the International Society of Gynecological Endocrinology, 27(12), 1094-1098 (2011-04-22)
The relative expression levels of estrogen receptor α (ERα) and mitochondrial cytochrome b (MTCYB) transcripts and their association with ERα, -397T > C gene polymorphism was determined in premenopausal uterine leiomyomas and myometrium tissues to gain an insight into the

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service