PEBP1 is a phosphatidylethanolamine binding protein that interacts with nucleotides and Raf-1 peptides. Studies in rat have revealed that PEBP1 is downregulated during hypoxia. Rabbit Anti-PEBP1 antibody recognizes human, mouse, chicken, canine, bovine, and rabbit PEBP1.
Immunogen
Synthetic peptide directed towards the C terminal region of human PEBP1
Application
Rabbit Anti-PEBP1 antibody is suitable for western blot applications at a concentration of 1.25μg/ml.
Biochem/physiol Actions
PEBP1 binds ATP, opioids and phosphatidylethanolamine. It has lower affinity for phosphatidylinositol and phosphatidylcholine. It is also a serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase.
Sequence
Synthetic peptide located within the following region: LSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Human Phosphatidylethanolamine binding protein 1 (hPEBP1) also known as Raf kinase inhibitory protein (RKIP), affects various cellular processes, and is implicated in metastasis formation and Alzheimer's disease. Human PEBP1 has also been shown to inhibit the Raf/MEK/ERK pathway. Numerous reports
Journal of molecular neuroscience : MN, 41(1), 36-47 (2009-08-26)
In order to understand dementia and other ailments associated with high altitude hypoxia, adult Sprague Dawley male rats were exposed to simulated conditions of high altitude (7,500 m above sea level, 59 mmHg) for a period of 5 days and
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.