AV38189

Anti-PSMC2 antibody produced in rabbit

IgG fraction of antiserum

• Synonym(s): Anti-Proteasome (prosome, macropain) 26S subunit, ATPase, 2
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 49 kDa
• species reactivity: dog, rabbit, rat, bovine, guinea pig, human, mouse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_002794
• UniProt accession no.: Q3LIA5
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... PSMC2(5701)

Description

Immunogen

Synthetic peptide directed towards the N terminal region of human PSMC2

Biochem/physiol Actions

PSMC2 is one of the ATPase subunits. This subunit has been shown to interact with several of the basal transcription factors so, in addition to participation in proteasome functions, this subunit may participate in the regulation of transcription. This su

Sequence

Synthetic peptide located within the following region: MPDYLGADQRKTKEVEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVED

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable