Skip to Content
MilliporeSigma
All Photos(4)

Documents

AV32386

Sigma-Aldrich

Anti-SIRT1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Sirtuin (silent mating type information Regulation 2 homolog) 1 (S. cerevisiae)

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

82 kDa

species reactivity

rabbit, horse, guinea pig, rat, human, bovine, dog, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SIRT1(23411)

General description

Rabbit polyclonal anti-SIRT1 antibody reacts with chicken, human, mouse, rat, canine, and pig sirtuin-1 enzymes.
Sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae) (SIRT1), a member of the NAD(+)-dependent protein deacetylase SIRT family, is involved in the regulation of nuclear transcription of genes involve in energy metabolism. SIRT1 provides a link between cellular energy status sensing (NAD(+) status) and the regulation of energy homoeostasis. SIRT1 is involved in the regulation of metabolism, cell differentiation and senescence, stress response, and cancer.

Immunogen

Synthetic peptide directed towards the N terminal region of human SIRT1

Application

Rabbit Anti-SIRT1 antibody can be used for western blot applications at a concentration of 0.5μg/ml.
Rabbit polyclonal anti-SIRT1 antibody is used to tag sirtuin-1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of sirtuin-1 in NAD(+) status-dependent energy homeostasis at the level of nuclear transcription control and protein deacetylation.

Biochem/physiol Actions

SIRT1 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined;

Sequence

Synthetic peptide located within the following region: PETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKI

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Éverton Lopes Vogt et al.
International journal of environmental research and public health, 18(14) (2021-07-25)
Introduction and objectives: Obesity represents a major global public health problem. Its etiology is multifactorial and includes poor dietary habits, such as hypercaloric and hyperlipidic diets (HFDs), physical inactivity, and genetic factors. Regular exercise is, per se, a tool for
Knut H Lauritzen et al.
Neurobiology of aging, 48, 34-47 (2016-09-18)
Mitochondrial genome maintenance plays a central role in preserving brain health. We previously demonstrated accumulation of mitochondrial DNA damage and severe neurodegeneration in transgenic mice inducibly expressing a mutated mitochondrial DNA repair enzyme (mutUNG1) selectively in forebrain neurons. Here, we
Yan Li et al.
International journal of molecular medicine, 41(6), 3517-3526 (2018-03-14)
Mitochondrial dynamics have critical roles in aging, and their impairment represents a prominent risk factor for myocardial dysfunction. Mitochondrial deacetylase sirtuin (SIRT)3 contributes greatly to the prevention of redox stress and cell aging. The present study explored the role of SIRT3
Moez Eid et al.
Frontiers in physiology, 13, 782684-782684 (2022-05-17)
Sirtuins (SIRTs) are NAD+- dependent histone deacetylases. They are involved in a variety of biological pathways and are thought to be a promising target for treating several human disorders. Although evidence is piling up to support the neuroprotective role of
Svetlana Demyanenko et al.
Journal of stroke and cerebrovascular diseases : the official journal of National Stroke Association, 29(10), 105152-105152 (2020-09-12)
Sirtuins, class III histone deacetylases, are involved in the regulation of tissue repair processes and brain functions after a stroke. The ability of some isoforms of sirtuins to circulate between the nucleus and cytoplasm may have various pathophysiological effects on

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service