Skip to Content
MilliporeSigma
All Photos(2)

Documents

AV32264

Sigma-Aldrich

Anti-ETV5 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Ets variant gene 5 (Ets-related molecule)

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

58 kDa

species reactivity

rat, bovine, horse, guinea pig, mouse, rabbit, dog, human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ETV5(2119)

General description

ETV5 loss has been linked to spermatogonial stem cell loss and infertility. Rabbit Anti-ETV5 (AB2) antibody recognizes human, mouse, rat, bovine, and canine ETV5.
Rabbit polyclonal anti-ETV5 antibody reacts with human, mouse, rat, bovine, and canine ETS variant gene 5 transcription factors.
Transcription factor ets variant gene 5 (ETV5/ERM) has various function in male reproduction. ETV5 regulates sertolic cell chemokines involved in stem/progenitor spermatogonia maintenance and is essential for spermatogonial stem cell (SSC) self-renewal.

Immunogen

Synthetic peptide directed towards the N terminal region of human ETV5

Application

Rabbit Anti-ETV5 (AB1) antibody can be used for western blot applications at 1μg/ml.
Rabbit polyclonal anti-ETV5 antibody is used to tag ETS variant gene 5 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of ETS variant gene 5 in spermatogonia maintenance and self-renewal.

Biochem/physiol Actions

ETV5 Contains 1 ETS DNA-binding domain and belongs to the ETS family. The ETV5 gene expression is regulated by the conventional PKC (cPKC) pathway.ETV5 is subject to SUMO modification and this post-translational modification causes inhibition of transcription-enhancing activity Phosphorylated ETV5 and the actin cytoskeleton regulate CD44-mediated hyaluronan binding in myeloid cells. ERMs (ezrin/radixin/moesin) function as adaptor molecules in the interactions of adhesion receptors and intracellular tyrosine kinases. ETV5 can cooperate with c-Jun and has a role in progression of breast cancer

Sequence

Synthetic peptide located within the following region: AQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Heather N Schlesser et al.
Biology of reproduction, 78(3), 483-489 (2007-11-23)
The transcription factor ets variant gene 5 (ETV5; also known as ERM) is essential for self-renewal of spermatogonial stem cells (SSCs). Mice with targeted disruption of Etv5 (Etv5(-/-)) undergo the first wave of spermatogenesis, but all SSCs are lost during

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service