AMAB90988

Monoclonal Anti-PDIA3 antibody produced in mouse

Prestige Antibodies^® Powered by Atlas Antibodies, clone CL2444, purified immunoglobulin, buffered aqueous glycerol solution

• Synonym(s): Monoclonal Anti-ERp57, Monoclonal Anti-ERp60, Monoclonal Anti-ERp61, Monoclonal Anti-GRP57, Monoclonal Anti-GRP58, Monoclonal Anti-HsT17083, Monoclonal Anti-P58, Monoclonal Anti-PI-PLC
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: CL2444, monoclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• enhanced validation: RNAi knockdown; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• technique(s): immunoblotting: 1 μg/mL; immunofluorescence: 2-10 μg/mL; immunohistochemistry: 1:5000- 1:10000
• isotype: IgG1
• immunogen sequence: PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK
• UniProt accession no.: P30101
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PDIA3(2923)

Description

General description

Monoclonal Anti-PDIA3 Prestige Antibodies^® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and

PDIA3 (protein disulfide isomerase family A member 3) is also known as ERp57. It is present in the cytoplasm, nucleus and endoplasmic reticulum. ERp57 is a constituent of the multimeric spermatozoa-zona pellucida (ZP) receptor complex. This gene is located on human chromosome 15q15.

Immunogen

Protein disulfide isomerase family A, member 3

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Monoclonal Anti-PDIA3 antibody has been used in immunofluorescence.

Biochem/physiol Actions

PDIA3 (protein disulfide isomerase family A member 3) participates in virus induced endoplasmic reticulum stress (ERS). It plays a major role in tumorigenesis. ERp57 is involved in the generation of major histocompatibility complex class I (MHC I) to impact the immunogenicity of tumor cells. It also regulates the thiol-disulphide status of proteins. PDIA3 is linked with several diseases like, cancer, prion disorders, Alzheimer′s disease and Parkinson′s diseases.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86567

Physical form

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1