Skip to Content
Merck
All Photos(8)

Key Documents

HPA010807

Sigma-Aldrich

Anti-B4GALT1 antibody produced in rabbit

enhanced validation

Ab2, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-β-1,4-GalTase 1 antibody produced in rabbit, Anti-β-1,4-Galactosyltransferase 1 antibody produced in rabbit, Anti-β4Gal-T1 antibody produced in rabbit, Anti-UDP-Gal:β-GlcNAc β-1,4-galactosyltransferase 1 antibody produced in rabbit, Anti-UDP-galactose:β-N-acetylglucosamine β-1,4-galactosyltransferase 1 antibody produced in rabbit, Anti-b4Gal-T1 antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

immunogen sequence

LPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKM

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... B4GALT1(2683)

Looking for similar products? Visit Product Comparison Guide

General description

B4GALT1 (UDP-Gal:βGlcNAc β 1,4- galactosyltransferase, polypeptide 1) belongs to a family of type II transmembrane proteins called glycosyltransferases, which resides in Golgi apparatus. This family consists of seven members, from GALT1 to GALT7. B4GALT1 has two isoforms, having different cellular locations, because of differences in their cytoplasmic domains. The long isoform is localized to the cell surface, whereas the short isoform is found in the Golgi apparatus. This gene is located on human chromosome 9p13, and codes for a protein containing 398 amino acids. It is expressed in most tissues, excluding adult brain and fetal heart and brain.

Immunogen

β-1,4-Galactosyltransferase 1 recombinant protein epitope signature tag (PrEST)

Application

Anti-B4GALT1 antibody produced in rabbit has been used in immunofluorescence microscopyand immunoblotting.

Biochem/physiol Actions

B4GALT1 (UDP-Gal:βGlcNAc β 1,4- galactosyltransferase, polypeptide 1) is responsible for the synthesis of galactose β-1,4-N-acetylglucosamine (Galβ1-4GlcNAc) groups on glycoproteins, on their N-linked sugar chains. This is performed by the short isoform of B4GALT1, which resides in Golgi bodies. The long isoform, localized to the cell surface, helps in cell adhesion, by interacting with N-acetylglucosamine containing oligosaccharides, which are found in the extracellular matrix. In patients with rheumatoid arthritis, it is involved in the inflammatory response in the synovial tissue. B4GALT1 plays an important role in the proliferation of MCF-7 breast cancer cells by interacting with estrogen receptor. It is methylated and down-regulated in colorectal cancer patients, and hence, can act as a marker of invasive phenotype of colorectal cancer.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71676

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Maria Podinovskaia et al.
eLife, 10 (2021-12-01)
Cell-cell communication is an essential process in life, with endosomes acting as key organelles for regulating uptake and secretion of signaling molecules. Endocytosed material is accepted by the sorting endosome where it either is sorted for recycling or remains in
The dimeric structure of wild-type human glycosyltransferase B4GalT1
Harrus D, et al.
Testing, 13(10), e0205571-e0205571 (2018)
Calreticulin Is Involved in Invasion of Human Extravillous Trophoblasts Through Functional Regulation of Integrin beta 1
Yamamoto M, et al.
Endocrinology, 158(11), 3874-3889 (2017)
Deborah Harrus et al.
PloS one, 13(10), e0205571-e0205571 (2018-10-24)
Most glycosyltransferases, including B4GalT1 (EC 2.4.1.38), are known to assemble into enzyme homomers and functionally relevant heteromers in vivo. However, it remains unclear why and how these enzymes interact at the molecular/atomic level. Here, we solved the crystal structure of
Engineered sialylation of pathogenic antibodies in vivo attenuates autoimmune disease
Pagan JD, et al.
Cell, 172(3), 564-577 (2018)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service