SAB2109014

Anti-KCNH3 (N-terminal) antibody produced in rabbit

affinity isolated antibody

• Synonim(y): BEC1, ELK2, KIAA1282, Kv12.2
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 117 kDa
• reaktywność gatunkowa (przewidywana na podstawie homologii): canine, rabbit, human, horse, rat, guinea pig, bovine, mouse
• stężenie: 0.5 mg/mL
• metody: western blot: 1 μg/mL
• numer dostępu NCBI: NM_012284
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... KCNH3(57396)

Opis

Opis ogólny

KCNH3 is a pore-forming (alpha) subunit of voltage-gated potassium channel. It elicits an outward current with fast inactivation. Channel properties may be modulated by cAMP and subunit assembly.

Sekwencja

Synthetic peptide located within the following region: AELILYRKSGLPFWCLLDVIPIKNEKGEVALFLVSHKDISETKNRGGPDR

Postać fizyczna

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): nwg
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable