SAB2104752

Anti-INSR antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-CD220, Anti-HHF5
• UNSPSC Code: 12352203
• NACRES: NA.41
• MDL number: MFCD01633540
• Conjugate: unconjugated
• Clone: polyclonal
• Application: IHC, WB
• Citations: 6

Właściwości

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 154 kDa
• species reactivity: mouse, rat, pig, human, horse, dog, rabbit
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable, western blot: suitable
• NCBI accession no.: NM_000208
• UniProt accession no.: P06213
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... INSR(3643)

Opis

Immunogen

Synthetic peptide directed towards the middle region of human INSR

Biochem/physiol Actions

This receptor binds insulin and has a tyrosine-protein kinase activity. Isoform Short has a higher affinity for insulin. INSR mediates the metabolic functions of insulin. INSR binding to insulin stimulates association of the receptor with downstream media

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: ENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCR

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable