SAB1412411

ANTI-BMP5 antibody produced in mouse

clone 2A5, purified immunoglobulin, buffered aqueous solution

• Synonim(y): BMP5, MGC34244
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 2A5, monoclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: antigen 36.74 kDa
• reaktywność gatunkowa: human
• metody: indirect ELISA: suitable
• izotyp: IgG2aκ
• numer dostępu NCBI: NM_021073.1
• numer dostępu UniProt: P22003
• Zastosowanie: research pathology
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... BMP5(653)

Opis

Opis ogólny

This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. This protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors. (provided by RefSeq)

Immunogen

BMP5 (NP_066551.1, 341 a.a. ~ 440 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVIL

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable