SAB1402503

Monoclonal Anti-ZNF256, (C-terminal) antibody produced in mouse

clone 3H7, purified immunoglobulin, buffered aqueous solution

• Synonim(y): BMZF-3, BMZF3
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: 3H7, monoclonal
• Application: ELISA (c), ELISA (i), IF, IHC (p), WB
• Citations: -

Właściwości

• biological source: mouse
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3H7, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37.88 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable, immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, indirect ELISA: suitable, western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: NM_005773
• UniProt accession no.: Q9Y2P7
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ZNF256(10172)

Opis

Immunogen

ZNF256 (NP_005764.2, 521 a.a. ~ 627 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CNECGKFFSQSSSLIRHRRSHTGERPYECSECWKSFSNHSSLVKHRRVHTGERPYECSECGKSFSQSSNLTNHQRIHSGERPYECSDCGKFFTFNSNLLKHQNVHKG

Physical form

Solution in phosphate buffered saline, pH 7.4

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• wgk: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable