HPA037568

Anti-SPA17 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonim(y): Anti-CT22, Anti-SP17, Anti-Sperm autoantigenic protein 17
• Kod UNSPSC: 12352203
• Numer w atlasie ludzkich białek: HPA037568
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• linia produktu: Prestige Antibodies^® Powered by Atlas Antibodies
• Postać: buffered aqueous glycerol solution
• reaktywność gatunkowa: human
• rozszerzona walidacja: orthogonal RNAseq; recombinant expression; Learn more about Antibody Enhanced Validation
• metody: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:1000-1:2500
• sekwencja immunogenna: EQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVK
• numer dostępu UniProt: Q15506
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... SPA17(53340)

Opis

Opis ogólny

Sperm autoantigenic protein 17(SPA17), also known as SP17, is encoded by the gene mapped to human chromosome 11q24.2. The encoded protein belongs to the family of cancer/testis antigens (CTAs). SPA17 is composed of 151 amino acids and has a molecular mass of 24.5kDa. It contains an N-terminal cAMP-dependent protein kinase A regulatory IIα (PKA RIIα) subunit-like domain, a central heparin binding domain and a C-terminal calmodulin binding domain. hSPA17 is specifically expressed in testis. In addition, it is also found in ciliated epithelia of the respiratory airways and both the male and female reproductive systems.

Immunogen

sperm autoantigenic protein 17 recombinant protein epitope signature tag (PrEST)

Zastosowanie

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-SPA17 antibody produced in rabbit has been used in immunohistochemical analysis.

Działania biochem./fizjol.

Sperm autoantigenic protein 17′s (SPA17) primary function is inducing the binding of sperm to the zona pellucida. The encoded protein is highly expressed by non-small cell lung cancer (NSCLC) cells and primary lung cancer tissues. Thus, SPA17 is considered to be a potential immunotherapeutic target against SP17 (+) NSCLC. It is also overexpressed in various other cancer tissues such as multiple myelomas, ovarian cancers, esophageal squamous cell carcinomas, esthesioneuroblastomas and various histological subtypes of human nervous system (NS) malignancies.

Cechy i korzyści

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST80499

Postać fizyczna

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable