HPA010860
Anti-SPTLC1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonim(y):
Anti-LCB 1 antibody produced in rabbit, Anti-Long chain base biosynthesis protein 1 antibody produced in rabbit, Anti-SPT 1 antibody produced in rabbit, Anti-SPT1 antibody produced in rabbit, Anti-Serine palmitoyltransferase 1 antibody produced in rabbit, Anti-Serine-palmitoyl-CoA transferase 1 antibody produced in rabbit
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
Polecane produkty
pochodzenie biologiczne
rabbit
białko sprzężone
unconjugated
forma przeciwciała
affinity isolated antibody
rodzaj przeciwciała
primary antibodies
klon
polyclonal
linia produktu
Prestige Antibodies® Powered by Atlas Antibodies
Postać
buffered aqueous glycerol solution
reaktywność gatunkowa
human
metody
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50- 1:200
sekwencja immunogenna
KTYKLQERSDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPR
numer dostępu UniProt
Warunki transportu
wet ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... SPTLC1(10558)
Opis ogólny
SPTLC1 (serine palmitoyltransferase, long chain base subunit 1) makes a heterodimer with SPTLC2, which forms the enzyme serine palmitoyltransferase (SPT). SPT resides in the outer membrane of endoplasmic reticulum (ER). SPTLC1 gene maps to human chromosome 9q22.2. This protein has a molecular weight of 53kDa, and is expressed in nucleus, focal adhesions as well as ER. It has multiple putative PDZ binding motifs and a transcription cofactor motif (LXXLL).
Immunogen
Serine palmitoyltransferase 1 recombinant protein epitope signature tag (PrEST)
Zastosowanie
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Działania biochem./fizjol.
Serine palmitoyltransferase (SPT) participates in sphingolipid biosynthesis by catalyzing the first step. It catalyzes the condensation of L-serine with palmitoyl-CoA. SPTLC1 (serine palmitoyltransferase, long chain base subunit 1) also resides in focal adhesions, which suggests that it either plays a role in, or is essential for maintaining the normal morphology of cell. As this protein contains the transcription cofactor motif (LXXLL), it might also act as a transcriptional co-regulator that shuttles between the nucleus and cytoplasm. Mutations in SPTLC1 are associated with hereditary sensory neuropathy type 1 (HSN1), which is characterized by length-dependent axonal degeneration. HSN1 cells show abnormalities in mitochondria and ER stress, which are the results of SPTLC1 mutations. Mutation in Ser331residue of this protein, is linked to the early-onset and severe phenotype of HSN1.
Cechy i korzyści
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Powiązanie
Corresponding Antigen APREST71690
Postać fizyczna
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informacje prawne
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Not finding the right product?
Try our Narzędzie selektora produktów.
Kod klasy składowania
10 - Combustible liquids
Klasa zagrożenia wodnego (WGK)
WGK 1
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Środki ochrony indywidualnej
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certyfikaty analizy (CoA)
Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Molecular Profile of Human Serine
Palmitoyltransferase-1 Proximate of
Chromosome 9 Disease Susceptibility Gene Cluster in Inflammatory Cancer Cell Lines
Palmitoyltransferase-1 Proximate of
Chromosome 9 Disease Susceptibility Gene Cluster in Inflammatory Cancer Cell Lines
Tokunbo Y
Journal of Cancer Therapy, 5, 885-901 (2014)
Bum Chun Suh et al.
Molecular medicine reports, 9(2), 481-486 (2013-11-20)
Hereditary sensory and autonomic neuropathy type I (HSAN I) is an autosomal dominant disease characterized by prominent sensory impairment, resulting in foot ulcers or amputations and has a juvenile to adult onset. The major underlying causes of HSAN I are
Simon J Myers et al.
DNA and cell biology, 33(7), 399-407 (2014-03-29)
Mutations in serine palmitoyltransferase long chain subunit 1 (SPTLC1) cause the typical length-dependent axonal degeneration hereditary sensory neuropathy type 1 (HSN1). Transmission electron microscopy studies on SPTLC1 mutant lymphoblasts derived from patients revealed specific structural abnormalities of mitochondria. Swollen mitochondria
Jia Wei et al.
Biochimica et biophysica acta, 1791(8), 746-756 (2009-04-14)
Serine palmitoyltransferase (SPT) has been localized to the endoplasmic reticulum (ER) by subcellular fractionation and enzymatic assays, and fluorescence microscopy of epitope-tagged SPT; however, our studies have suggested that SPT subunit 1 might be present also in focal adhesions and
Gongshe Han et al.
Proceedings of the National Academy of Sciences of the United States of America, 106(20), 8186-8191 (2009-05-07)
Serine palmitoyltransferase (SPT) catalyzes the first committed step in sphingolipid biosynthesis. In yeast, SPT is composed of a heterodimer of 2 highly-related subunits, Lcb1p and Lcb2p, and a third subunit, Tsc3p, which increases enzyme activity markedly and is required for
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej