AV54594

Anti-ARCN1 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-Archain 1, Anti-COPD
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 3

Właściwości

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 57 kDa
• species reactivity: dog, mouse, bovine, human, guinea pig, rat
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_001646
• UniProt accession no.: P48444
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ARCN1(372)

Opis

Immunogen

Synthetic peptide directed towards the middle region of human ARCN1

Application

Anti-ARCN1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

ARCN1 gene encodes an intracellular protein, which is the δ subunit of coat protein I (COPI) complex and is localized on chromosome 11 at 11q23.3. It is a 57kD protein consisting of C-terminal domain (CTD) and an N-­terminal longin domain. The encoded protein facilitates the retrograde transport of proteins and lipids from the cis-Golgi network to the endoplasmic reticulum and intra-Golgi membranes. Single nucleotide polymorphism in ARCN1 gene increases the risk of Glioma.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: GGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFT

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable