AV54369

Anti-NKIRAS2 (AB1) antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-DKFZP434N1526, Anti-KBRAS2, Anti-KappaB-Ras2, Anti-MGC74742, Anti-NFKB inhibitor interacting Ras-like 2
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 1

Właściwości

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 21 kDa
• species reactivity: rabbit, bovine, mouse, horse, pig, human, rat, dog
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_060065
• UniProt accession no.: Q9NYR9
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... NKIRAS2(28511)

Opis

Immunogen

Synthetic peptide directed towards the middle region of human NKIRAS2

Application

Anti-NKIRAS2 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

NKIRAS2 (NFKB inhibitor interacting Ras-like 2) encodes a protein that belongs to Ras family and κB-Ras subfamily. NKIRAS2 interacts with PEST domains of IκBα and IκBβ [inhibitors of the transcription factor nuclear factor κ B (NF-κB)] and decreases their rate of degradation.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: KKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLE

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable