Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Key Documents

AV54307

Sigma-Aldrich

Anti-LIG1 antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-Ligase I, DNA, ATP-dependent, Anti-MGC117397, Anti-MGC130025

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(1)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

102 kDa

reaktywność gatunkowa

guinea pig, rabbit, human, mouse, dog

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NP_000225

numer dostępu UniProt

P18858

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... LIG1(3978)

Immunogen

Synthetic peptide directed towards the middle region of human LIG1

Zastosowanie

Anti-LIG1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Działania biochem./fizjol.

LIG1 gene encodes an enzyme that belongs to ATP-dependent DNA ligase protein family. The protein plays a crucial role in sealing the nicks in double-stranded DNA during DNA replication, DNA recombination and DNA repair. Mutation or defects in LIG1 gene results in Bloom′s syndrome cells.

Sekwencja

Synthetic peptide located within the following region: ALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDR

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Rüveyda Dok et al.
International journal of cancer, 146(4), 1075-1085 (2019-07-10)
Radiotherapy is one of the most used treatment approaches for head and neck squamous cell carcinoma (HNSCC). Targeted inhibition of DNA repair machinery has the potential to improve treatment response by tailoring treatment to cancer cells lacking specific DNA repair
J H Petrini et al.
Proceedings of the National Academy of Sciences of the United States of America, 88(17), 7615-7619 (1991-09-01)
Alteration of DNA ligase I activity is a consistent biochemical feature of Bloom's syndrome (BS) cells. DNA ligase I activity in BS cells either is reduced and abnormally thermolabile or is present in an anomalously dimeric form. To assess the
Timothy R L Howes et al.
Sub-cellular biochemistry, 62, 327-341 (2012-08-25)
Multiple DNA ligation events are required to join the Okazaki fragments generated during lagging strand DNA synthesis. In eukaryotes, this is primarily carried out by members of the DNA ligase I family. The C-terminal catalytic region of these enzymes is
Mark R Taylor et al.
The Journal of biological chemistry, 286(26), 23054-23062 (2011-05-13)
DNA ligase I (LIG1) catalyzes the ligation of single-strand breaks to complete DNA replication and repair. The energy of ATP is used to form a new phosphodiester bond in DNA via a reaction mechanism that involves three distinct chemical steps:

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej