AV51319

Anti-GP1BA antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-BSS, Anti-CD42B, Anti-CD42b-α+F12935, Anti-GP1B, Anti-Glycoprotein Ib (platelet), α polypeptide, Anti-MGC34595
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 3

Właściwości

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 68 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_000164
• UniProt accession no.: P07359
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... GP1BA(2811)

Opis

Immunogen

Synthetic peptide directed towards the C terminal region of human GP1BA

Application

Anti-GP1BA antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.

Biochem/physiol Actions

Glycoprotein Ib (GP1BA) is a membrane glycoprotein present on the surface of platelets. It acts as the receptors for von Willebrand factor that facilitates the adhesion of platelets to vascular subendothelium after vascular injury, thrombosis, platelet activation and hemostasis. Mutations in GP1BA are associated with Bernard-Soulier syndromes and platelet-type von Willebrand disease.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable