Przejdź do zawartości
Merck

AV50821

Sigma-Aldrich

Anti-LIN9 (AB2) antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-BARA, Anti-BARPsv, Anti-Lin-9, Anti-Lin-9 homolog (C. elegans), Anti-TGS, Anti-TGS1

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

53 kDa

reaktywność gatunkowa

guinea pig, horse, mouse, bovine, dog, human, rat, rabbit

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

informacje o genach

human ... LIN9(286826)

Immunogen

Synthetic peptide directed towards the N terminal region of human LIN9

Zastosowanie

Anti-LIN9 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.

Działania biochem./fizjol.

Lin-9 homolog (C. elegans) is a tumor suppressor that associates with retinoblastoma 1 protein and inhibits DNA synthesis and regulates cell cycle and cell cycle-dependent gene expression. LIN9 is a subunit of DREAM complex and regulates gene expression and proliferation of embryonic stem cells.

Sekwencja

Synthetic peptide located within the following region: TRKLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVA

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Nina Reichert et al.
Molecular and cellular biology, 30(12), 2896-2908 (2010-04-21)
The retinoblastoma tumor suppressor protein (pRB) and related p107 and p130 "pocket proteins" function together with the E2F transcription factors to repress gene expression during the cell cycle and development. Recent biochemical studies have identified the multisubunit DREAM pocket protein
Jasmina Esterlechner et al.
PloS one, 8(5), e62882-e62882 (2013-05-15)
The DREAM complex plays an important role in regulation of gene expression during the cell cycle. We have previously shown that the DREAM subunit LIN9 is required for early embryonic development and for the maintenance of the inner cell mass

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej