AV50505

Anti-AIM2 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-Absent in melanoma 2, Anti-PYHIN4
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 7

Właściwości

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 39 kDa
• species reactivity: human, horse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_004824
• UniProt accession no.: O14862
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... AIM2(9447)

Opis

General description

The gene AIM2 (Absent in melanoma 2) is mapped to human chromosome 1q22. It belongs to the IFI20X /IFI16 family. AIM2 transcripts are detected in spleen, small intestine, testis and peripheral blood leukocytes.

Immunogen

Synthetic peptide directed towards the N terminal region of human AIM2

Application

Anti-AIM2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

Absent in melanoma 2 (AIM2) is induced by IFN-γ. The probable roles of AIM2 are regulation of cell proliferation, inflammation and benign prostate hyperplasia. It also suppresses proliferation and tumorigenicity of human breast cancer cells. AIM2 is a suppressor of melanoma tumorigenicity. AIM2 is up-regulated in humans with hepatitis B virus-associated glomerulonephritis. AIM2 expression was positively correlated with caspase-1 and IL (Interleukin)-1β expression. AIM2 is also a component of inflammasome and can sense cytoplasmic DNA, causing activation of ASC (apoptosis-associated speck-like protein containing a CARD) pyroptosome and caspase-1.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: ESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATL

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 12 - Non Combustible Liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable